nic.ac

This is a snapshot from a website nic.ac taken at 2024/08/22 00:40:01

NIC.AC is the official registry and Network Information Centre for .AC domains - the AC - academic extension for students and teachers. Claim your .AC domain today.

Our automated technical analysis of nic.ac website and it's covering network is reported that selling goods or services, might users need to sign up / sign in, mostly speaks in English language.

Table Of Contents

E-mail Account Settings for nic.ac

Full SEO page report insights for Free

nic.ac headlines

Website technical analysis of proper use of H1,H2,H3 tags

nic.ac used Keywords

Technical analysis of most used and strong keywords

nic.ac ISP / network and whois lookup / contact

nic.ac Page Speed, Time to first Byte analysis, deadlink detection

Headlines - H1,H2,H3 Tags very important and their hierarchia for crawlers

404 not foundconnect with ac domain namescontact uspoliciesterms and conditionssupport centerwhois searchprivacy statementit's ac ademicbenefits of ac tldanyone anywhere can register dot acget your ac websitefor registry servicesfor registrar servicesac registry services faqyour whois informationlegal & service agreementsmy cartnic acdomain namessupportlegaladding to cart1 definitions2 fees and payments

Keywords - The most relevant keywords, (3 words) (2 words) (single word)

your username orforgot your usernameproceed to checkoutusername or passwordterms & conditionsadding to cartyour personal informationthis privacy statementyou are securelyare securely loggedsecurely logged ininternet computer bureauin create accountsign in createcomputer bureau ltdac domain namesprivacy statement forplease see ourour privacy statementthe right toaccount log outmade during checkoutchanges can beaddons changes cancreate account forgot

includes addons changesaccount forgot yourprice includes addonslogged in managetotal price includesbe made duringmy cart checkoutcan be mademanage account logdetails click tomore details clickfor more detailsstatement for moreclick to acceptsee our privacyin manage accountanywhere can registeranyone anywhere canthe registration agreementget your acof the sitedispute resolution policyterms and conditions404 not foundbr6 0nz united0nz united kingdom221-227 high streetorpington br6 0nzhouse 221-227 highgreytown house 221-227street orpington br6high street orpingtonduring checkout proceedpassword you arecart checkout totalor password youcheckout proceed tocheckout total priceby name comfirst come firstcome first servedof your personalthe applicant agreeswith ac domainconnect with acyour ac websitecan register dotregister dot acof ac tldbenefits of acit's ac ademicapplicant agrees thatthe domain nameif you haveon a firstfirst served basisa first comepurchase domain whoisallocation rules policiesconditions allocation rulesdomain whois searchwhois search services& conditions allocationa domain nameplease contact usthis website usescenter legal termswebsite uses cookiesall rights reservedwelcome sign insearch services supportpowered by name200 denver colorado1997-2021 internet computerare essential forbureau ltd allown ac domainour privacy policiesessential for partssupport support centerac home domainchanged please seename com 414recently changed pleasehave recently changedpolicies have recentlyto accept iservices support supportused are essentialnic ac homesupport center legalout my cartcopyright © 1997-2021registrar services poweredthe cookies usedprivacy policies havestreet 200 denverhome domain namesdomains are issuedthe site toare issued onthe registration ofyour own acvat number gb311515842kingdom vat numberunited kingdom vatrights reserved greytowndenver colorado 80202414 14th streetlog out myoperate please seeac domains areof the cookiesltd all rightsof the registrationaccept i acceptreserved greytown housesome of thenames purchase domain14th street 200uses cookies somesitemap | contactlegal terms &domain names purchaseissued on asite to operatecom 414 14thof a domainthe ac domainac domain nameservices powered bycookies some ofparts of theac domain todayto operate pleasecookies used arerules for acfor ac disputeac dispute resolutionfor registrar servicesfor registry servicesget yours now—thereuse your domainyour domain immediatelydomain immediately getimmediately get yoursattractive high-value acyours now—there arenow—there are manyare many attractivemany attractive high-valueyou can usecan use yourending in acand you canregister and youto register andeasy to registerand easy toquick and easyare quick andac are quickin ac aredomain names stillnames ending indomain names endingand web addresshigh-value ac domainacademic institutions registernames still availableaccepted quickly andin the worldanywhere in thefrom anywhere indomain from anywhereyour domain fromto your domainaccess to yourfast access toquickly and efficientlyare accepted quicklystill available toregistrations are acceptedregister registrations arein other tldsregister in otherinstitutions register inuk email andthat academic institutionsadvisable that academicis advisable thatit is advisablenote it isavailable to registeremail and webcan register registrationsco uk emailpersonal ac domainduring and aftertouch during andin touch duringkeep in touchto keep indomain to keepac domain toa personal acafter college anduse a personalcan use ainstructors can useand instructors canstudents and instructorsand after collegeor co ukcollege and aand easy-to-remember anda com orgcom org ororg or colike a comsimple and easy-to-rememberand a permanenta permanent emailpermanent email addressemail address lifetimeaddress lifetime connectionslifetime connections simplifiedac names arenames are simpleare simple andeasy-to-remember and workand work justwork just likejust like aprivacy statementi acceptnic acdomain namessupport centerof thecreate accountpersonal informationlog outproceed tomanage accountor passwordusername oryour usernameforgot yourto checkoutwhois search& conditionsterms &purchase domainallocation rulesmy cartac domainthe applicantdomain nameto cartadding tothe sitein theyou areyour personalfor theif youthe registrationto thethis privacyour privacysign inare securelylogged insecurely loggedcomputer bureaucontact usinternet computerin createto acceptbureau ltdcan bewe willwe mayright tothe rightfor morestatement forsee ourplease seename combe madethe domainof acdetails clickin managetotal priceaccount forgotduring checkoutcart checkoutaccount logclick tomore detailsprice includesaddons changesmade duringincludes addonschanges candispute resolutionregistration agreementregistrar servicesuse ofmay beof youryou haveanywhere cananyone anywherecan registerto beyour acget yourof anynon-personal informationof ouron thesuch asunited kingdomresolution policysite tothird partyof adoes notour siteand otherand conditionsterms andnot found404 notcheckout proceedcheckout totalpassword youby nameregistry servicesfirst comecome firstfirst servedac websitegreytown househigh street221-227 highorpington br6house 221-227street orpingtonbr6 0nz0nz unitedapplicant agreesrules foragrees thatby theregistration ofregister dotdot acac tldbenefits ofit's acwith acconnect withac ademicco ukto registerwww namethe registrythe applicant'sa domainshall becan useyour domainthe rulesdomains areac areconditions allocationsearch servicesrules policiesdomain whoisit isfor registrarfor registryuse yourmany attractivenow—there areand youeasy toand easyquick andare quickending innames endingweb addressstill availableavailable toaccepted quicklythe worldanywhere infrom anywhereemail andto youraccess tofast accessand efficientlyquickly andare acceptednote itregistrations areregister registrationsin otherregister ininstitutions registeradvisable thatis advisableand webare manyuk emailpersonal acafter collegeand afterduring andto keepstudents andinstructors canuse aand aa personaldomain tokeep inin touchtouch duringnames arecollege andsimple andac namesconnections simplifiedcom orgemail addressaddress lifetimeare simplepermanent emaillifetime connectionsjust likeand instructorseasy-to-remember andand workwork justor colike aa comorg orand easy-to-remembera permanent© 1997-2021yours now—thereget yoursimmediately getdomain immediatelyhigh-value acattractive high-valuein acyou canregister andnames stilldomain fromother tldsacademic institutionsthat academicyourdomainprivacyinformationstatementaccountcheckoutacceptservicessupportcartnamescontactwithcenternamerulestermsthatthispoliciesconditionspersonalsitecreatemanagewhoissearchpurchasewelcomeproceedpasswordusernameforgotallocationhomeregistrationsitemaphavepleasecookiesapplicantotherwillsuchlegalpolicyserviceaddingfromregisterdataaddresswebsiteemailinternetchangesshallagreementfirstsignsecurelythirdcomputerrightcollectloggedwhichduringdetailsbureauthesestreetaccessmoreprovidepartyrequestanywhereregistrardisputeincludesresolutionsecuritymaderegistryclicktransferrightspriceaddonstotalfoundnumberanyoneprovidedconnecthouseusedtimeonlynon-personalkingdomunitedserveddomainsrenewalagreescome221-227highbenefitsademicit'sgb311515842greytownorpingtonagentapplicant'sbasissomeobtainlevelaccuracyapplicationmeansnoticefastreservedchangedloginissuedessentialoperatetoday1997-2021poweredcoloradoparts80202recentlycopyrightyoursnow—theremanyattractivehigh-valuestillavailableeasynoteworldacademicinstitutionstldsregistrationsacceptedquicklyefficientlyimmediatelyadvisablequickcollegeendingstudentsinstructorskeeptouchafterpermanentworkjustlifetimelikeeasy-to-rememberconnectionssimplifiedsimpledenver14thusesoverbeenyearscommunityglobalsecurebecometechnicianscustomerexperiencedinfrastructuretechnicalreliable

Website info about nic.ac

Loading

Page	Time to First Byte	Status
NIC.AC - The Official .AC Domain Registry and Network Information Centre /	627.26 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - Services /services.htm	626.79 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - Contact /contact.htm	626.56 ms	HTTP/200
/sitemap.htm	626.3 ms	HTTP/200
/policy.htm	626.19 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - rules /rules.htm	625.96 ms	HTTP/200
/terms.htm	625.68 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - FAQ /faq.htm	625.47 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - Whois Search /whois-search.htm	625.3 ms	HTTP/200
404 Not Found ...IvJ9w7t2PnIKNOL6EQ0oq-UumRJYmQHMUMmhvf3MZ11uinWlu7ZvC/tF.htmlview_lang=en_US&o=1	625.04 ms	HTTP/200
....ac - the .ac domain registry and network information centre - register a domain /new.htm	624.87 ms	HTTP/200
NIC.AC - The Official .AC Domain Registry and Network Information Centre /index.htm	624.68 ms	HTTP/200
404 Not Found /cart/splash.htmlview_lang=en_US	624.44 ms	HTTP/200
404 Not Found /login-1.htmllogout	624.26 ms	HTTP/200
My Account /login.html	725.97 ms	HTTP/200
404 Not Found ...jLSBhY4t3vtJSvlgpuyHkduBMiFF1ymuuTpUzIr8iUYmHBDIR8DZ0y1vX/wZ.htmlview_lang=en_US	725.85 ms	HTTP/200
My Account /legal/legal_privacy.html	725.71 ms	HTTP/200
NIC.AC - The Official .AC Domain Registry and Network Information Centre /dashboard.html	2728.04 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - Services /index.htmllogout	2728.43 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - Contact /legal/legal_cookie.html	2728.64 ms	HTTP/200
...eNvVRnXehomzluesZAfjMN1UwOiljenC3OajfWh_wh0KRjt2f8DhAZVEbsWspnB2MHJtW2mu/Ed.html	2728.84 ms	HTTP/200
...0bjfvEparCQM6ny4P510dQfRXAvg0RpntZfeR5Kibc9PaK6nlX1RnK1XCL5CnB4VUuDn0WhP/UN.html	2729.08 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - rules ...3BnDK7b49TmDShjDC5VPp-RwytIC_8nG1MqynjluuYyMdwtfnHnLDx_V-Dk2HF42N2Jr2DCI/Eo.html	2729.25 ms	HTTP/200
...nfECdhgxc1u4L20kGcDDUesMG_sTi0OqTExDhVrcD8EruGPpz6U07-olV0vk0UNwrkSFdqta/OF.html	2729.44 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - FAQ ...xEZu37X6T4QsMBX5ASwlOBgahGOR1RyBrkkxDbhdj1ep2w2eHzhKlW3S_DhSYztP5jUR3MQw/SJ.html	2729.62 ms	HTTP/200
nic.ac - the .ac domain registry and network information centre - Whois Search /index.html	2729.81 ms	HTTP/200
404 Not Found ...mQaVm93bA8sDrXpg9h-kxkb9ULgQPlg6ehdFJd3usO7btdvz809VavL71nrLZaQ8LGMdSmOrHHo.html	2729.99 ms	HTTP/200
....ac - the .ac domain registry and network information centre - register a domain ...sbLZGgFTJMsYD9X8UKlX8lwXJl-JYh7cXsLS1XExnXQrpAfN3DEyFbJl-W-Y6crrWriujHzz/2X.html	2730.16 ms	HTTP/200
NIC.AC - The Official .AC Domain Registry and Network Information Centre ...4mr81D-OUpwZJKzl3SEzGN3dclYGdD-Ua6Vofpo2rg382az6sGegTlFevqF_8o6lVCCw-IaC/AG.html	2730.31 ms	HTTP/200
404 Not Found ...VlMGrLBeNE3RHhqIXy5Es_EwN8lpyAd7DHQDiVWxqu-zp_3BB8lbd4ywYTkFZrXQokcfHGEo/KK.html	2730.52 ms	HTTP/200
404 Not Found /legal/legal_abuse.html	2730.7 ms	HTTP/200
My Account ...HXGnF8E3As2r4Zxrrj_CTM7gw3cYsnvJKSTc6zhb_LNu91ZMoKVo8M8zicvg9tSA1qc3s97z/dg.html	2730.91 ms	HTTP/200
404 Not Found ...7eWihKKXta6scZwhc2SPR7LkwdbKNWmm9QONoojQMqxqLajy2p6D1TvAe1A5u_NIwmIYmryc/bH.html	2731.11 ms	HTTP/200
My Account ...jfz6jVFx2thqEIeM18dRf_goWWyupRyuqS8tr9YCwvyaDwAaUOAkSbZyL3dxyMZKnhsUGV-_/PQ.html	2730.83 ms	HTTP/200
...oM5vQaPjOcTfGMIUYUHyHavNCO4eJ6BUIx7FgoVzyXvlDBxyW0yokQHWFDzYZIrrByRDjxWP/bY.html	2731.07 ms	HTTP/200
...67TrCSxmNTSARwsHNu-RjvBPKCiNWi7Y9-gkpFLKfn3Yg9aAC207et0nQqtVM7BBm2rcWE-doqE.html	2731.34 ms	HTTP/200
...LOQUGj20AvuPxf4dIv-gEfDxr7dVb8ppVfqnRH9wIx0tX_2h7wIIbo_Z5JLxDx8W3tYWqRUX/Eh.html	2731.34 ms	HTTP/200
...Ub_eOjNBy7eHYGGzd9pRo30x8zUl8Pgulcagj26Sm-3vPpRsh5YHFbolV3uCJhuab8ohWmKo/aD.html	2730.81 ms	HTTP/200
/index-2.htm	2731.06 ms	HTTP/200
/rules_for_dispute_policy.htm	2731.27 ms	HTTP/200
/dispute_policy.htm	2731.39 ms	HTTP/200
/index-3.htm	2731.6 ms	HTTP/200
/legal/legal_master.html	2731.71 ms	HTTP/200

Network informations and whois lookup for nic.ac

Network Info from nic.ac

Contact	SOA Serial
alerts@afilias.info	4167604459

IP	Location	Provider
75.2.38.108 ab8ed37e3b3f98a7a.awsglobalaccelerator.com	North America / United States	AMAZON-02
99.83.155.228 ab8ed37e3b3f98a7a.awsglobalaccelerator.com	North America / United States	AMAZON-02

IP/Target	Location	Provider
142.251.9.27 alt2.aspmx.l.google.com	North America / United States	GOOGLE
74.125.133.26 aspmx.l.google.com	North America / United States	GOOGLE
74.125.200.26 alt4.aspmx.l.google.com	North America / United States	GOOGLE
142.250.150.26 alt3.aspmx.l.google.com	North America / United States	GOOGLE
142.250.153.26 alt1.aspmx.l.google.com	North America / United States	GOOGLE

IP	Location	Provider
65.22.160.1 a0.nic.ac	North America / United States	AS-AFILIAS1
65.22.161.1 b0.nic.ac	North America / United States	AS-AFILIAS1
65.22.163.1 a2.nic.ac	North America / United States	Identity Digital Limited
65.22.162.1 c0.nic.ac	North America / United States	AS-AFILIAS1

E-Mail Account Settings for nic.ac

Are you trying to figure out what is nic.ac mailbox / mail account settings - find nic.ac mail settings below.

Please keep in mind these informations gathered based on nic.ac network settings, it mostly works and correct, but might contains errors.

Outgoing SMTP Settings for nic.ac

Host	Port	Security Settings
smtp.gmail.com	587	STARTTLS / TLS (Secure)

Incoming IMAP4 Settings for nic.ac

Host	Port	Security Settings
imap.gmail.com	993	SSL (Secure)

Incoming POP3 Settings for nic.ac

Host	Port	Security Settings
pop.gmail.com	995	SSL (Secure)

This session was sponsored by nPulse.net (AI) - the most advanced website analytics software

Network Analysis

NIC.AC - The Official .AC Domain Registry and Network Information Centre

Headlines - H1,H2,H3 Tags very important and their hierarchia for crawlers

Keywords - The most relevant keywords, (3 words) (2 words) (single word)

Website info about nic.ac

Loading

Network Info from nic.ac

nic.ac IP Address (A)

nic.ac IPv6 Address (AAAA)

nic.ac Mail Servers (MX)

nic.ac Name Servers (NS)

Outgoing SMTP Settings for nic.ac

Incoming IMAP4 Settings for nic.ac

Incoming POP3 Settings for nic.ac

Free Website SEO analytics for nic.ac

Credits and Partners

nic.acGo BackReload Content

NIC.AC - The Official .AC Domain Registry and Network Information Centre

Headlines - H1,H2,H3 Tags very important and their hierarchia for crawlers

Keywords - The most relevant keywords, (3 words) (2 words) (single word)

Website info about nic.ac

Loading

Network Info from nic.ac

nic.ac IP Address (A)

nic.ac IPv6 Address (AAAA)

nic.ac Mail Servers (MX)

nic.ac Name Servers (NS)

Outgoing SMTP Settings for nic.ac

Incoming IMAP4 Settings for nic.ac

Incoming POP3 Settings for nic.ac

Free Website SEO analytics for nic.ac

Credits and Partners

nic.ac