Loading
MDI Biological Laboratory – Pioneering New Approaches in Regenerative Medicine
Our automated technical analysis of mdibl.org website and it's covering network is reported that publishing news, mostly speaks in English language.
Table Of Contents
Headlines - H1,H2,H3 Tags very important and their hierarchia for crawlers
whoops something went wrongfaciltiespioneering new approaches in regenerative medicinesimulated biological systemshigh throughput imagingthis is whyearly-stage in vivo profilingadvanced bioinformaticshamilton pondbirch hallspruce hallmyers pavilionmartha and wistar morris laboratorykathryn w davis center for regenerative biology and agingsmith-kingsley buildingmaine center for biomedical innovation (mcbi)star pointtrailsabout mdi biological laboratorymdibl dockour location & culturemaren auditoriumour leaders are doersimpact report 2022mdi biological laboratory’s long legacy
125 years of science by the searesearchundergraduate and high school programsresearch facultyresearch programsdining hallmaine inbre networkdahlgren hallinventing new tools for kidney-grafting biotech403 - forbiddenblogin the mediapress releasespublicationscontact media affairssupport usthere are so many ways to make your impactget involvedstay informedseason brings snow studentsemery dormhow two summer students advanced science at mdi bio labbiome awards $6 000 to lab ph d candidate for muscle researchnoah lind finds a true science communitymdi biosciencegraduate and professional programscareerscontact mdi biological laboratorycenter for biomedical research excellence (cobre)eventswelcome to mdi biological laboratoryscientific resourcesnoah lind finds a true science community125 years of science by the seaa legacy of givingpostdoctoral researchan integral experienceour lab partnersbringing history into the modern agea legacy to nurture curious mindsbeyond the naked eyethis is why your gift mattersour donors2013-beyond1999-20121960-19981930-19591898-1929current financial documentssupport our research and education programs with a gift todayspecial funds and 2022 recipientscores and advisory committeessee your impact on our education programstogether we moved science forwardwe had a tremendously productive year and your partnership made it possible than...view our interactive campus mapnewsresearchlife at mdi bio labjoin our mailing listgive your gift todaylaunching bioscience careers at mdi bio labinto the futurevisiting scientistsrecurring givingwe are building on a remarkable foundationjohn s kingsley societymdi biological laboratory partnersspecial funds2022 faculty fellowship recipients2022 student fellow recipientsearly leaders marine organisms & model systems for human physiologyseeing deeper cell development membranes & transportphysiology & its context toxins tissues & environmenta new vision year-round research expanded training & educationour growth new labs new models & a focus on aging & regenerationhigh school programsummer undergraduate research fellowships (surf)gifts received in memoryfacultycobreinbrekathryn w davis center for regenerative biology and agingscience education partnership award (sepa)bioinformatics corelight microscopy facilityanimal resources coreresearch laboratoriesconference facilitiesgifts received in honorfriends of mdiblthe star point societya traffic cop for genes and diseasecreate your legacymaine center for biomedical innovationmaren conference centerhousing and diningdonate now subscribeattend an eventgraduate and post-graduate fellowsthe mdi bio lab fellowship experiencecurrent openingsbreakthroughs that lead to transformative therapiesan ideal locationlab assistantfinding usexecutive teamsenior leadershipboard of trusteesscientific advisory boardpresident's cabinetread mdibl president hermann haller's message to youstar point society leadership councilstar point society laureatestar point society principal investigatorresearch fellowhousingbiome awards $6 000 to lab ph d candidate for muscle researchseason brings snow studentscontact mdi biosciencerelated facultyinventing new tools for kidney-grafting biotechhow two summer students advanced science at mdi bio labdata science team explores new protein functionsquestionssupport usmdi bioscience$2 500 to $4 999$5 000+robert taft whitman president's cabinet$1 000 to $2 499anna maynard president's cabineteric n olson ph d scientific advisory boardleonard zon m d scientific advisory boardpeter walter ph d scientific advisory boardandres villu maricq m d ph d scientific advisory boardbrad thompson m d scientific advisory boardelly tanaka ph d scientific advisory boardalejandro sánchez alvarado ph d scientific advisory boardnadia rosenthal ph d fmedsci faahms scientific advisory boardtom rapoport ph d scientific advisory boardthomas rando m d ph d scientific advisory boardjane r m harrison president's cabinetbilly g hudson ph d scientific advisory boardkenneth poss ph d scientific advisory boarddennis l shubert m d ph d trusteejohn a hays trusteeanne lehmann trusteeanna maynard trusteealan b miller esq trusteei wistar morris iii trusteebetsy myers ph dmargaret myers m d trusteechristopher p sighinolfi cfa trusteebenjamin d humphreys m d ph d scientific advisory boardbruce a stanton ph d trusteedaphne w trotter esq trusteerobert taft whitman trusteecorinne antignac ph d scientific advisory boardbarbara beltz ph d scientific advisory boarddennis brown ph d scientific advisory boardjonathan a epstein m d scientific advisory board$500 to $999$1 to $249$250 to $499rebekka schneider m d ph d rwth aachen universitytilman jobst-schwan m d university hospital erlangenbrett d keiper ph d brody school of medicine at east carolina universityrafael kramann m d ph d fasn rwth aachen universitycatherine mccusker ph d university of massachusetts bostontaiowa montgomery ph d colorado state universityelena pokidysheva ph d vanderbilt university medical centermario schiffer m d m b a professor of medicine university hospital erlangenjuyoung shim ph d university of maine at augustaerik figura medizinische hochschule hannover (mhh)patricio silva m d temple universitydeena small ph d university of new englandbruce a stanton ph d dartmouth collegejens titze m d duke nusfabian voigt ph d harvard universityaccess to state-of-the-art infrastructurethe new kid on the blockgert fricker ph d heidelberg universitykaren crawford ph d st mary's college of marylandroy forsterjames a coffman ph d associate professor director maine idea network of biomedic...james godwin ph d advances prospect of regeneration in humanssigmar h gabriel trusteeresearch facultyresearch programsscientific resourcesfacilities (research)apply to surf fellowshipjane e disney ph d associate professor of environmental healthhellmut augustin dvm ph d heidelberg university and german cancer research cente...iain drummond ph d professor and director davis center for aging and regeneratio...james godwin ph d assistant professorjoel h graber ph d senior staff scientist director of computational biology and ...hermann haller m d president professor mdi biological laboratory professor direc...romain madelaine ph d assistant professorprayag murawala ph d assistant professoraric rogers ph d associate professordustin updike ph d associate professorhermann haller m d trustee ex officiojanis l coates ph d secretaryruth cserr trusteewe can all play a role in ensuring a healthier tomorrowmdi biological laboratory hires new communications chiefmount desert island biological laboratory unveils new tracing app as covid-19 ca...breaking through the way science should bebreaking through creating a center of biomedical research excellencebreaking through finding new ways to light up biologybreaking through fall 2020this is whyscientists reveal an unexpected gene in wormsgiving opportunitiesget involvedstay informeddonor privacy and confidentiality policywhat the maine center for biomedical innovation offersbe social with usmdi biological laboratory blogcitizens students and scientists team up for bar harbor arsenic project$600k for mdi biological laboratory startup included in congressional spending b...2024 surf programcory johnson ph d — gsbse graduating student spotlighta post-doc builds proto-kidneys from scratchmdi bio lab scientists share salamander secretsjob growth boosts science capacity at mdi bio labmdi bio lab’s imaging experts’ excellence recognized (again)bar harbor biomedical lab plans to be 50 percent larger by 2030we’re seeing a remarkable moment in maine’s bioscience communitymeet 2023 raskin scholar alexis garretsondmm outstanding paper prize 2022 winners tamihiro kamata jennifer k sargent and ...nih awards $11 3 million for umaine/mdi bio lab research partnershipumaine names its 2023 outstanding graduating studentsstudy will examine how pfas affect older mainers’ healthhusson university students faculty share projects at 13th annual research showca...high levels of arsenic found in 6% of bar harbor wellseconomic analysis shows nih funding is vital for maine other rural statesmdi bio lab website wins international dotcomm awardaccomplished molecular biologist to lead new group at mdi biological laboratorysupport students like bidhi and sanjushreeleave your legacy at the mdi bio labterence c boylan trusteeroy mcmorran director of information technologyimpact report 2022diversity equity and inclusionhermann haller m d presidentiain drummond ph d professor and director kathryn w davis center for aging and r...claudine lurvey administrative directorjerilyn m bowers vice president of external affairs and chief of staffmark hanscome director of facilitieschris smith director of courses conferences and evaluationour leadershipjames s strickland director mdi biosciencehook wheeler director of human resourcesalan w kornberg esq chairmanedward j benz jr m d vice chairmanthomas a boyd ph d treasurerjames l boyer m d honorary trusteephoebe c boyer trusteeour historyour location & cultureabout mdi biosciencemaine has a high quality of lifeearly-stage in vivo profilingsimulated biological systemsadvanced bioinformaticshigh throughput imaginglaunching bioscience careers at mdi bio labbenefitsaccommodationsfood services manager- year-round dining halla formula that worksproject coordinator community labscience communication specialist community labaquaculture technician i animal corestreet addressmailing addresscurrent cobre projectsinbre network websiteresearch facilitiesmdi biological laboratory bar harbor megeorge b dorrbodil schmidt-nielsenthomas h marendavid a karnofskye k marshallhomer w smithmargaret r and warren h lewisulric dahlgrendisease models and transgenic biosensorsherbert v nealjohn sterling kingsleyflyingdrivingearly assessment of efficacy and toxicity in whole organismshigh throughput screening and advanced imagingfranklin h epstein’seducationpage not foundblogmore from the blogbreaking throughenvironmentbiotechnologyagingour locationregenerative biologycelebrating 125 years of cutting-edge science on maine's rugged coastmdi biosciencesupport usthis is whyjaspreet kohlichuck dinsmore ph dnoah lindelisabeth marnik ph dhannah somersgabie johnsonanastasia gianakas and diane saundersmike haysgary and giva frashierdon and heather parkergeneral newsiain drummond ph d scientific director of mdi bio lab’s kathryn w davis center...give now2022 was a year of collaborationfebruary 12 2024 • 5 00 - 6 00 pm (online-only zoom event)mdi science caféour historic 100-year-old campus on maine’s rugged coast is informal and inspi...abigail wick 2023 surfmake an impactfeaturedmicroscopyresearch toolsleadershipdrug discoveryother bioinformaticscollaborationsregenerationa timeline of mdi bio lab’s odyssey of discovery
Keywords - The most relevant keywords, (3 words) (2 words) (single word)
biomedical research excellenceof biomedical researchstar point societythis is whycenter for biomedicalmdi biological laboratorysimulated biological systemsin vivo profilinghigh throughput imagingearly-stage in vivoidea network ofnetwork of biomedicallocation & culturefor biomedical researchvisiting scientist programand high schoolundergraduate and highgraduate and professionalin the mediasupport mdibl withwith a donationa donation todayfellowships & trainingmdibl with amdi bio lab
scientific advisory boardd scientific advisoryph d scientificthe mdi biologicalat mdi biod research sited ph dm d phlab ph dbiome awards $6to lab phfor muscle researchcandidate for muscled candidate forph d candidateawards $6 000$6 000 to000 to labthe mdi biobar harbor meph d researchbrings snow studentsseason brings snowold bar harbormdi bio lab’s159 old barmr and mrssite mdi biologicalresearch site mdibar harbor rdharbor me 04609rd bar harborharbor rd barkathryn w davisscientific resources facilitiesgiving get involvedbiological laboratory •& culture leadershippress releases publications• mdi biologicalresearch faculty researchrights reserved •• all rightsis why givingdonate now monthlytoday search scientist program scientificwhy giving opportunitiesmdi bioscience early-stagelegacy giving geteducation conferences coursesexcellence visiting scientistreleases publications mediaresearch research facultynow monthly givinggiving opportunities donatecontact support thisresearch excellence ideaschool graduate andevents about locationopportunities donate nowhistory timeline contactbioinformatics high throughputfacilities mdi bioscienceprivacy policy 159policy 159 olddonation today searchnews blog inadvanced bioinformatics highfacilities education conferencespublications media contactreport history timelinetraining undergraduate andfaculty research programslaboratory • all2024 • mdimedia contact support• privacy policythroughput imaging newsmedia press releasescourses fellowships &impact report historyreserved • privacyand professional facilitiesgiving star pointtimeline contact researchcorporation impact reportprograms center forinbre events aboutblog in thesupport this ishigh school graduateleadership corporation impactvivo profiling simulated& training undergraduateimaging news blogabout location &research programs centerbioscience early-stage insystems advanced bioinformaticspoint society legacymonthly giving starbiological systems advancedcontact research researchresources facilities educationculture leadership corporationthe media pressprogram scientific resourcescobre inbre eventsinvolved stay informedexcellence idea networkall rights reservedprofessional facilities mdiresearch excellence visitingcareers cobre inbresociety legacy givingget involved stayprofiling simulated biologicalconferences courses fellowshipsw davis centerhermann haller mhaller m dtwo summer studentsnew tools forinventing new toolshow two summeradvanced science atsummer students advancedstudents advanced sciencescience at mdifor kidney-grafting biotechtools for kidney-graftingtrue science communitya true sciencenoah lind findsfinds a truelind finds adavis center fordrummond ph diain drummond phph d and125 years ofwhoops something wentsomething went wrongby the seascience by theof science byyears of sciencelaboratory bar harborbiological laboratory barcontact mdi biosciencefor biomedical innovationmaine center forin regenerative medicineexplore our interactiveour interactive timelineremarkable moment ina remarkable momentjennifer k sargentoutstanding paper prizejohnson ph dcory johnson phbar harbor biomedicalmaine’s bioscience community2023 raskin scholarnew approaches inapproaches in regenerativepioneering new approachesa legacy tocareers at mdibringing history intohistory into theis why yourwhy your giftyour gift mattersbeyond the nakedthe naked eyeinto the modernbioscience careers atlaunching bioscience careersnurture curious mindsthe modern agea legacy oflegacy of givingan integral experienceour lab partnersto nurture curiouslegacy to nurtureshare salamander secretsexperts’ excellence recognizedbio lab’s imagingdmm outstanding paperimaging experts’ excellenceexcellence recognized (again)job growth boostsgrowth boosts scienceboosts science capacityscience capacity atpaper prize 2022lab’s imaging experts’capacity at mdiand students aremaine's rugged coastcelebrating 125 yearsof cutting-edge scienceyears of cutting-edgecutting-edge science onlearn more blogscience on maine'son maine's ruggedbiological laboratory isbioengineering was ledvisiting scientists leifnew research publishedpublished in thein the journalthe journal bioengineeringjournal bioengineering wasrisky endeavor onlywas led byled by formerm ph dscientists leif oxburghand the mdioxburgh d vd v mv m phd and deniseand denise marcianodenise marciano mmarciano m dare working hardcomplex and riskydisease however theirresearch published informer visiting scientistsscientists and students5 000 newonly 1 indrug for addressing1 in 5in 5 000000 new discoveriesnew discoveries willdiscoveries will becomestudents are workingbecome an approvedapproved drug forfor addressing humannew approaches toan approved drughuman disease mdidisease mdi biosciencemdi bioscience worksbioscience works withworks with pharmaceuticalwith pharmaceutical companiesaddressing human diseaseour scientists andwill become anph dbiomedical researchresearch excellencein thecenter formdi biosciencebiological laboratorystar pointof biomedicalmdi biologicalfor biomedicalpoint societythis isis whyhigh schoolnetwork ofresearch programswith ahigh throughputidea networkvisiting scientistdonate nowbiological systemssimulated biologicalgraduate andvivo profilingthroughput imagingin vivoearly-stage inadvanced bioinformaticsstay informedscientific resourcesresearch facultyimpact reportget involvedlocation && cultureand highgiving opportunitiesundergraduate andscientist programprivacy policypress releasesand professionalthe mediaa donationmedia contactlegacy givingsupport mdiblmdibl withdonation todaymonthly giving& trainingfellowships &m dcontinue readingmdi biobio lablearn moreof thethe mdiadvisory boardscientific advisorybar harbord scientificat theat mdiuniversity ofto theresearch sitesearch and mrsd researchd ph000 toand the$6 000d candidatefor muscleawards $6muscle researchcandidate forto lablab phbiome awardsdavis centerharbor meon thedirector ofbio lab’sbrings snowsnow studentsseason bringsread morebreaking through2024 •hermann hallerby theand agingold barregenerative biologymr andsite mdi159 oldcontact usharbor rdme 04609rd baryour giftfor thed andfaculty researchw daviskathryn wresearch researchtimeline contactcontact researchcobre inbre• privacyeducation conferencespublications mediareserved •• mdifacilities educationtools fornoah lindtraining undergraduateprograms centernew toolsscience atadvanced sciencestudents advancedtwo summersummer studentsfor kidney-graftingkidney-grafting biotechinventing newhow twoscience communityfor moresupport ustrue sciencea truefinds alind findsyears of125 yearssomething wentof sciencescience bythe seaa legacylaboratory barcontact mdinew approachesinteractive timelineour interactiveexplore ourresearchgivingbiomedicalsupportbiologicalcontactexcellencehighfacilitiesmediascientificwithcenterlaboratoryeducationbiosciencefacultythisschoolmoreprogramsgraduatemdiblvisitingadvancedsocietypointblogbioinformaticsstaraboutimagingsystemsundergraduateresourcesnetworkhistorylegacyprograminbrescientistcareersnewstodaylocationopportunitiescoursesimpactconferenceseventsleadershiptrainingdonatecultureideathroughputinvolvedearly-stagesimulatedprivacyvivoprofilinginformedfellowshipsstaypublicationspolicyreporttimelinecobrepressprofessionalreleasesmonthlydonationcorporationcontinuereadinguniversitysciencestudentsthatmainelearnfromadvisoryboardharbordirectortrusteesummerscientistsyourprofessorfundbiologyagingcommunitythroughworksearchsitemusclejames2024awardsislandsbiomereadmentorcandidatesnowhallbringsseasondiseasebreakinggift2023kidneyrepublicyearssaintlindnoahtoolsfindstruebiotechinventingkidney-graftingapproachesexploreinteractive
Website info about mdibl.org
Loading
| Page | Time to First Byte | Status |
|---|---|---|
| MDI Biological Laboratory – Pioneering New Approaches in Regenerative Medicine / | 719.2 ms | HTTP/200 |
| This Is Why – MDI Biological Laboratory /support/this-is-why/ | 2051.76 ms | HTTP/200 |
| Early-Stage In Vivo Profiling – MDI Biological Laboratory /mdi-bioscience/early-stage-in-vivo-profiling/ | 718.6 ms | HTTP/200 |
| Simulated Biological Systems – MDI Biological Laboratory /mdi-bioscience/simulated-biological-systems/ | 828.59 ms | HTTP/200 |
| Advanced Bioinformatics – MDI Biological Laboratory /mdi-bioscience/advanced-bioinformatics/ | 934.91 ms | HTTP/200 |
| High Throughput Imaging – MDI Biological Laboratory /mdi-bioscience/high-throughput-imaging/ | 620.09 ms | HTTP/200 |
| 403 - Forbidden /news/ | 834.9 ms | HTTP/200 |
| Blog – MDI Biological Laboratory /news/blog/ | 618.95 ms | HTTP/200 |
| In the Media – MDI Biological Laboratory /news/in-the-media/ | 834.42 ms | HTTP/200 |
| Press Releases – MDI Biological Laboratory /news/press-releases/ | 618.53 ms | HTTP/200 |
| Publications – MDI Biological Laboratory /news/publications/ | 618.4 ms | HTTP/200 |
| Contact Media Affairs – MDI Biological Laboratory /contact-media-affairs/ | 618.27 ms | HTTP/200 |
| Support Us – MDI Biological Laboratory /support/ | 1351.81 ms | HTTP/200 |
| Giving Opportunities – MDI Biological Laboratory /support/giving-opportunities/ | 1149.32 ms | HTTP/200 |
| Facilities (Education) – MDI Biological Laboratory /education/education-facilities/ | 617.74 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /support/giving-opportunities/donate-now/section=make-an-immediate-gift | 1858.48 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /support/giving-opportunities/labpartner/section=become-a-lab-partner | 1148.93 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory ...pport/giving-opportunities/the-star-point-society/section=the-star-point-society | 1149.04 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /support/giving-opportunities/making-a-planned-gift/section=create-your-legacy | 1959.46 ms | HTTP/200 |
| Get Involved – MDI Biological Laboratory /support/get-involved/ | 1451.41 ms | HTTP/200 |
| Stay Informed – MDI Biological Laboratory /support/stay-informed/ | 1553.42 ms | HTTP/200 |
| Inventing New Tools for Kidney-Grafting Biotech – MDI Biological Laboratory /inventing-new-tools-for-kidney-grafting-biotech/ | 831.26 ms | HTTP/200 |
| Season Brings Snow, Students! – MDI Biological Laboratory /season-brings-snow-students/ | 1553.1 ms | HTTP/200 |
| ...wo Summer Students Advanced Science at MDI Bio Lab – MDI Biological Laboratory /how-two-summer-students-advanced-science-at-mdi-bio-lab/ | 615.86 ms | HTTP/200 |
| ... $6,000 to Lab Ph.D. Candidate for Muscle Research – MDI Biological Laboratory /biome-awards-6000/ | 2160.53 ms | HTTP/200 |
| Noah Lind Finds a True Science Community – MDI Biological Laboratory /noah-lind-finds-a-true-science-community/ | 830.71 ms | HTTP/200 |
| MDI Bioscience – MDI Biological Laboratory /mdi-bioscience/ | 615.22 ms | HTTP/200 |
| Graduate and Professional Programs – MDI Biological Laboratory /education/fellowships-training/graduate-and-professional-programs/ | 615.13 ms | HTTP/200 |
| Careers – MDI Biological Laboratory /careers/ | 615.01 ms | HTTP/200 |
| Contact – MDI Biological Laboratory /contact/ | 614.84 ms | HTTP/200 |
| Center for Biomedical Research Excellence (COBRE) – MDI Biological Laboratory /research/research-programs/center-for-biomedical-research-excellence/ | 614.69 ms | HTTP/200 |
| IDeA Network of Biomedical Research Excellence – MDI Biological Laboratory /research/research-programs/idea-network-of-biomedical-research-excellence/ | 614.54 ms | HTTP/200 |
| Events – MDI Biological Laboratory /events/ | 614.42 ms | HTTP/200 |
| Interactive Map – MDI Biological Laboratory /interactive-map/ | 614.28 ms | HTTP/200 |
| About – MDI Biological Laboratory /about/ | 614.13 ms | HTTP/200 |
| Our Location & Culture – MDI Biological Laboratory /about/our-location-culture/ | 830.24 ms | HTTP/200 |
| Our Leadership – MDI Biological Laboratory /about/our-leadership/ | 613.69 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /about/our-leadership/corporation/section=corporation | 1650.09 ms | HTTP/200 |
| Impact Report 2022 – MDI Biological Laboratory /about/impact-report-2022/ | 721.18 ms | HTTP/200 |
| Our History – MDI Biological Laboratory /about/our-history/ | 721.05 ms | HTTP/200 |
| Timeline – MDI Biological Laboratory /about/our-history/timeline/ | 720.9 ms | HTTP/200 |
| Research – MDI Biological Laboratory /research/ | 720.71 ms | HTTP/200 |
| Undergraduate and High School Programs – MDI Biological Laboratory /education/fellowships-training/undergraduate-and-high-school-programs/ | 720.55 ms | HTTP/200 |
| Research Faculty – MDI Biological Laboratory /research/research-faculty/ | 720.42 ms | HTTP/200 |
| Research Programs – MDI Biological Laboratory /research/research-programs/ | 720.25 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory ...biomedical-research-excellence/section=center-for-biomedical-research-excellence | 1749.38 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory ...dical-research-excellence/section=idea-network-of-biomedical-research-excellence | 1850.94 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory .../research-programs/visiting-scientist-program/section=visiting-scientist-program | 2154.66 ms | HTTP/200 |
| Scientific Resources – MDI Biological Laboratory /research/scientific-resources/ | 828.64 ms | HTTP/200 |
| Facilities (Research) – MDI Biological Laboratory /research/research-facilities/ | 828.74 ms | HTTP/200 |
| MDI Biological Laboratory – Pioneering New Approaches in Regenerative Medicine /education/ | 618.03 ms | HTTP/200 |
| This Is Why – MDI Biological Laboratory /education/conferences/ | 617.63 ms | HTTP/200 |
| Early-Stage In Vivo Profiling – MDI Biological Laboratory /education/courses/ | 617.43 ms | HTTP/200 |
| Simulated Biological Systems – MDI Biological Laboratory /education/fellowships-training/ | 617.3 ms | HTTP/200 |
| Advanced Bioinformatics – MDI Biological Laboratory /privacy-policy/ | 617.16 ms | HTTP/200 |
| High Throughput Imaging – MDI Biological Laboratory /support/giving-opportunities/donate-now/ | 1036.86 ms | HTTP/200 |
| 403 - Forbidden /research/research-facilities/housing/ | 616.9 ms | HTTP/200 |
| Blog – MDI Biological Laboratory /data-science-team-explores-new-protein-functions/ | 1138.41 ms | HTTP/200 |
| In the Media – MDI Biological Laboratory /faculty/romain-madelaine-ph-d/ | 616.54 ms | HTTP/200 |
| Press Releases – MDI Biological Laboratory /faculty/prayag-murawala-ph-d/ | 616.58 ms | HTTP/200 |
| Publications – MDI Biological Laboratory /faculty/iain-drummond-ph-d/ | 616.51 ms | HTTP/200 |
| Contact Media Affairs – MDI Biological Laboratory /tag/zebrafish/ | 616.46 ms | HTTP/200 |
| Support Us – MDI Biological Laboratory /faculty/james-a-coffman-ph-d/ | 616.38 ms | HTTP/200 |
| Giving Opportunities – MDI Biological Laboratory /research/research-programs/kathryn-w-davis-center/ | 1035.11 ms | HTTP/200 |
| Facilities (Education) – MDI Biological Laboratory /support/giving-opportunities/making-a-planned-gift/ | 1034.98 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /tag/graduate-students/ | 616.4 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /research/research-programs/visiting-scientist-program/ | 616.3 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /education/contact-education/ | 616.18 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /launching-bioscience-careers-at-mdi-bio-lab/ | 1136.38 ms | HTTP/200 |
| Get Involved – MDI Biological Laboratory /leadership/christopher-sighinolfi/ | 615.9 ms | HTTP/200 |
| Stay Informed – MDI Biological Laboratory /leadership/corinne-antignac/ | 615.8 ms | HTTP/200 |
| Inventing New Tools for Kidney-Grafting Biotech – MDI Biological Laboratory /leadership/rob-whitman-2/ | 615.69 ms | HTTP/200 |
| Season Brings Snow, Students! – MDI Biological Laboratory /leadership/daphne-trotter/ | 615.59 ms | HTTP/200 |
| ...wo Summer Students Advanced Science at MDI Bio Lab – MDI Biological Laboratory /leadership/hermann-haller-m-d/ | 615.47 ms | HTTP/200 |
| ... $6,000 to Lab Ph.D. Candidate for Muscle Research – MDI Biological Laboratory /leadership/john-a-hays/ | 615.35 ms | HTTP/200 |
| Noah Lind Finds a True Science Community – MDI Biological Laboratory /leadership/anne-lehmann/ | 615.21 ms | HTTP/200 |
| MDI Bioscience – MDI Biological Laboratory /leadership/barbara-beltz-ph-d/ | 615.11 ms | HTTP/200 |
| Graduate and Professional Programs – MDI Biological Laboratory /leadership/bruce-stanton-ph-d/ | 615.01 ms | HTTP/200 |
| Careers – MDI Biological Laboratory /leadership/anna-maynard-trustee/ | 1134.21 ms | HTTP/200 |
| Contact – MDI Biological Laboratory /leadership/alan-miller/ | 614.75 ms | HTTP/200 |
| Center for Biomedical Research Excellence (COBRE) – MDI Biological Laboratory /leadership/wistar-morris/ | 614.63 ms | HTTP/200 |
| IDeA Network of Biomedical Research Excellence – MDI Biological Laboratory /leadership/margaret-myers-m-d/ | 614.51 ms | HTTP/200 |
| Events – MDI Biological Laboratory /leadership/dennis-shubert-m-d-ph-d/ | 1436.28 ms | HTTP/200 |
| Interactive Map – MDI Biological Laboratory /leadership/betsy-myers/ | 1133.27 ms | HTTP/200 |
| About – MDI Biological Laboratory /leadership/mark-hanscome/ | 1436.5 ms | HTTP/200 |
| Our Location & Culture – MDI Biological Laboratory /leadership/sigmar-gabriel/ | 613.88 ms | HTTP/200 |
| Our Leadership – MDI Biological Laboratory /leadership/roy-mcmorran/ | 1436.41 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /leadership/jonathan-a-epstein-m-d/ | 1436.55 ms | HTTP/200 |
| Impact Report 2022 – MDI Biological Laboratory ...research/research-programs/center-for-biomedical-research-excellence/cobre-news/ | 1538.64 ms | HTTP/200 |
| Our History – MDI Biological Laboratory /events/mdi-science-cafes/ | 715.9 ms | HTTP/200 |
| Timeline – MDI Biological Laboratory /events/art-meets-science/ | 715.79 ms | HTTP/200 |
| Research – MDI Biological Laboratory /event/a-traffic-cop-for-genes-and-disease/ | 715.7 ms | HTTP/200 |
| Undergraduate and High School Programs – MDI Biological Laboratory /leadership/hermann-haller-md/ | 1435.83 ms | HTTP/200 |
| Research Faculty – MDI Biological Laboratory /leadership/iain-drummond/ | 715.39 ms | HTTP/200 |
| Research Programs – MDI Biological Laboratory /leadership/15846/ | 715.23 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /leadership/jerilyn-m-bowers/ | 715.11 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /leadership/christine-smith/ | 1435.23 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /leadership/ruth-cserr/ | 714.79 ms | HTTP/200 |
| Scientific Resources – MDI Biological Laboratory /leadership/james-s-strickland/ | 714.65 ms | HTTP/200 |
| Facilities (Research) – MDI Biological Laboratory /leadership/hook-wheeler/ | 1434.87 ms | HTTP/200 |
| MDI Biological Laboratory – Pioneering New Approaches in Regenerative Medicine /category/biotechnology/ | 618.95 ms | HTTP/200 |
| This Is Why – MDI Biological Laboratory /this-is-why-chuck-dinsmore-ph-d/ | 618.61 ms | HTTP/200 |
| Early-Stage In Vivo Profiling – MDI Biological Laboratory /this-is-why-volunteer-mike-hays/ | 1140.6 ms | HTTP/200 |
| Simulated Biological Systems – MDI Biological Laboratory /don-and-heather-parker-a-legacy-of-giving/ | 1141.07 ms | HTTP/200 |
| Advanced Bioinformatics – MDI Biological Laboratory /this-is-why-jaspreet-kohli/ | 1141.2 ms | HTTP/200 |
| High Throughput Imaging – MDI Biological Laboratory /this-is-why-liz-marnik-ph-d-postdoctoral-researcher/ | 1141.24 ms | HTTP/200 |
| 403 - Forbidden /this-is-why-lab-partners/ | 1141.25 ms | HTTP/200 |
| Blog – MDI Biological Laboratory /category/aging/ | 617.81 ms | HTTP/200 |
| In the Media – MDI Biological Laboratory ...-unveils-new-tracing-app-as-covid-19-cases-rise-in-maine-and-across-new-england/ | 617.76 ms | HTTP/200 |
| Press Releases – MDI Biological Laboratory /category/microscopy/ | 1140.83 ms | HTTP/200 |
| Publications – MDI Biological Laboratory /mdi-bio-lab-scientists-share-salamander-secrets/ | 617.54 ms | HTTP/200 |
| Contact Media Affairs – MDI Biological Laboratory /category/education/ | 1140.65 ms | HTTP/200 |
| Support Us – MDI Biological Laboratory /category/environment/ | 1140.77 ms | HTTP/200 |
| Giving Opportunities – MDI Biological Laboratory /category/general-news/ | 617.22 ms | HTTP/200 |
| Facilities (Education) – MDI Biological Laboratory /category/kidney-disease/ | 1242.54 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /tiw-gabie-johnson/ | 617 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /category/philanthropy/ | 1140.09 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /category/regeneration/ | 1242.28 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /category/remembrance/ | 1242.4 ms | HTTP/200 |
| Get Involved – MDI Biological Laboratory /a-post-doc-builds-proto-kidneys-from-scratch/ | 616.34 ms | HTTP/200 |
| Stay Informed – MDI Biological Laboratory /beyond-the-naked-eye/ | 616.32 ms | HTTP/200 |
| Inventing New Tools for Kidney-Grafting Biotech – MDI Biological Laboratory ...k-for-mdi-biological-laboratory-startup-included-in-congressional-spending-bill/ | 616.24 ms | HTTP/200 |
| Season Brings Snow, Students! – MDI Biological Laboratory /category/bioinformatics/ | 1544.07 ms | HTTP/200 |
| ...wo Summer Students Advanced Science at MDI Bio Lab – MDI Biological Laboratory /mdi-bio-labs-imaging-experts-excellence-recognized-again/ | 616.04 ms | HTTP/200 |
| ... $6,000 to Lab Ph.D. Candidate for Muscle Research – MDI Biological Laboratory /in-the-media/bar-harbor-biomedical-lab-plans-to-be-50-percent-larger-by-2030/ | 1544.12 ms | HTTP/200 |
| Noah Lind Finds a True Science Community – MDI Biological Laboratory /in-the-media/were-seeing-a-remarkable-moment-in-maines-bioscience-community/ | 1544.17 ms | HTTP/200 |
| MDI Bioscience – MDI Biological Laboratory /in-the-media/meet-2023-raskin-scholar-alexis-garretson/ | 615.63 ms | HTTP/200 |
| Graduate and Professional Programs – MDI Biological Laboratory /in-the-media/cory-johnson-ph-d-gsbse-graduating-student-spotlight/ | 615.57 ms | HTTP/200 |
| Careers – MDI Biological Laboratory /in-the-media/dmm-outstanding-paper-prize/ | 1543.77 ms | HTTP/200 |
| Contact – MDI Biological Laboratory /in-the-media/umaine-names-its-2023-outstanding-graduating-students/ | 615.36 ms | HTTP/200 |
| Center for Biomedical Research Excellence (COBRE) – MDI Biological Laboratory /in-the-media/study-will-examine-how-pfas-affect-older-mainers-health/ | 615.21 ms | HTTP/200 |
| IDeA Network of Biomedical Research Excellence – MDI Biological Laboratory /in-the-media/high-levels-of-arsenic-found-in-6-of-bar-harbor-wells/ | 615.14 ms | HTTP/200 |
| Events – MDI Biological Laboratory /news/in-the-media/page/2/ | 615.06 ms | HTTP/200 |
| Interactive Map – MDI Biological Laboratory /press-release/mdi-biological-laboratory-hires-new-communications-chief/ | 1542.62 ms | HTTP/200 |
| About – MDI Biological Laboratory /news/in-the-media/page/3/ | 614.83 ms | HTTP/200 |
| Our Location & Culture – MDI Biological Laboratory /news/in-the-media/page/15/ | 614.76 ms | HTTP/200 |
| Our Leadership – MDI Biological Laboratory ...lease/economic-analysis-shows-nih-funding-is-vital-for-maine-other-rural-states/ | 1542.26 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /press-release/mdi-bio-lab-website-wins-international-dotcomm-award/ | 1542.33 ms | HTTP/200 |
| Impact Report 2022 – MDI Biological Laboratory ...accomplished-molecular-biologist-to-lead-new-group-at-mdi-biological-laboratory/ | 716.44 ms | HTTP/200 |
| Our History – MDI Biological Laboratory ...press-release/nih-awards-11-million-for-umaine-mdi-bio-lab-research-partnership/ | 716.33 ms | HTTP/200 |
| Timeline – MDI Biological Laboratory /press-release/scientists-reveal-an-unexpected-gene-in-worms/ | 716.21 ms | HTTP/200 |
| Research – MDI Biological Laboratory /news/blog/page/2/ | 1541.76 ms | HTTP/200 |
| Undergraduate and High School Programs – MDI Biological Laboratory /job-growth-boosts-science-capacity-at-mdi-bio-lab/ | 1541.84 ms | HTTP/200 |
| Research Faculty – MDI Biological Laboratory ...release/citizens-students-and-scientists-team-up-for-bar-harbor-arsenic-project/ | 1541.94 ms | HTTP/200 |
| Research Programs – MDI Biological Laboratory /wp-content/uploads/2023/03/2023-Donor-Privacy-and-Confidentiality-Policy.pdf | 715.65 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /careers/aquaculture-technician-i/ | 715.54 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /education/education-facilities/maine-center-for-biomedical-innovation/ | 1322.98 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /news/press-releases/page/3/ | 715.17 ms | HTTP/200 |
| Scientific Resources – MDI Biological Laboratory /news/press-releases/page/5/ | 715.04 ms | HTTP/200 |
| Facilities (Research) – MDI Biological Laboratory /publication/breaking-through-spring-2023/ | 714.93 ms | HTTP/200 |
| MDI Biological Laboratory – Pioneering New Approaches in Regenerative Medicine /faculty/dustin-updike-ph-d/ | 611.64 ms | HTTP/200 |
| This Is Why – MDI Biological Laboratory /faculty/rafael-kramann/ | 611.24 ms | HTTP/200 |
| Early-Stage In Vivo Profiling – MDI Biological Laboratory /leadership/alan-kornberg/ | 610.99 ms | HTTP/200 |
| Simulated Biological Systems – MDI Biological Laboratory /leadership/thomas-a-boyd-ph-d/ | 610.73 ms | HTTP/200 |
| Advanced Bioinformatics – MDI Biological Laboratory /leadership/jan-l-coates/ | 610.54 ms | HTTP/200 |
| High Throughput Imaging – MDI Biological Laboratory /faculty/aric-rogers-ph-d/ | 610.37 ms | HTTP/200 |
| 403 - Forbidden /leadership/james-l-boyer/ | 610.19 ms | HTTP/200 |
| Blog – MDI Biological Laboratory /leadership/phoebe-c-boyer/ | 610.04 ms | HTTP/200 |
| In the Media – MDI Biological Laboratory /leadership/terence-c-boylan/ | 609.88 ms | HTTP/200 |
| Press Releases – MDI Biological Laboratory /leadership/dennis-brown-ph-d/ | 1028.16 ms | HTTP/200 |
| Publications – MDI Biological Laboratory /faculty/joel-h-graber-ph-d/ | 609.55 ms | HTTP/200 |
| Contact Media Affairs – MDI Biological Laboratory /leadership/billy-hudson/ | 609.42 ms | HTTP/200 |
| Support Us – MDI Biological Laboratory /faculty/james-godwin-ph-d/ | 609.27 ms | HTTP/200 |
| Giving Opportunities – MDI Biological Laboratory /faculty/hermann-haller-m-d/ | 609.11 ms | HTTP/200 |
| Facilities (Education) – MDI Biological Laboratory /faculty/elena-pokidysheva/ | 1128.29 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory ...arch/research-programs/center-for-biomedical-research-excellence/cobre-research/ | 608.8 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /faculty/rebekka-schneider/ | 1026.59 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /faculty/karen-crawford/ | 1128.73 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /faculty/erik-figura/ | 1128.8 ms | HTTP/200 |
| Get Involved – MDI Biological Laboratory /faculty/vs2021-gert-fricker/ | 608.04 ms | HTTP/200 |
| Stay Informed – MDI Biological Laboratory /faculty/tilman-jobst-schwan/ | 1229.52 ms | HTTP/200 |
| Inventing New Tools for Kidney-Grafting Biotech – MDI Biological Laboratory /faculty/brett-douglas-keiper-ph-d/ | 607.72 ms | HTTP/200 |
| Season Brings Snow, Students! – MDI Biological Laboratory /faculty/catherine-mccusker-ph-d/ | 1128.05 ms | HTTP/200 |
| ...wo Summer Students Advanced Science at MDI Bio Lab – MDI Biological Laboratory /course/biomedical-bootcamp-2024/ | 607.39 ms | HTTP/200 |
| ... $6,000 to Lab Ph.D. Candidate for Muscle Research – MDI Biological Laboratory /faculty/taiowa-montgomery/ | 607.26 ms | HTTP/200 |
| Noah Lind Finds a True Science Community – MDI Biological Laboratory /leadership/edward-j-benz-jr-m-d/ | 607.12 ms | HTTP/200 |
| MDI Bioscience – MDI Biological Laboratory /leadership/ken-poss-ph-d/ | 606.98 ms | HTTP/200 |
| Graduate and Professional Programs – MDI Biological Laboratory /faculty/hellmut-augustin/ | 606.84 ms | HTTP/200 |
| Careers – MDI Biological Laboratory /faculty/juyoung-shim/ | 606.7 ms | HTTP/200 |
| Contact – MDI Biological Laboratory /faculty/deena-small/ | 1227.86 ms | HTTP/200 |
| Center for Biomedical Research Excellence (COBRE) – MDI Biological Laboratory /faculty/bruce-stanton-ph-d/ | 606.36 ms | HTTP/200 |
| IDeA Network of Biomedical Research Excellence – MDI Biological Laboratory /faculty/jens-titze-m-d/ | 1430.1 ms | HTTP/200 |
| Events – MDI Biological Laboratory /faculty/fabian-voigt/ | 1430.33 ms | HTTP/200 |
| Interactive Map – MDI Biological Laboratory /faculty/jane-e-disney-ph-d/ | 605.81 ms | HTTP/200 |
| About – MDI Biological Laboratory /education/fellowships-training/reu-summer-fellowships/ | 605.66 ms | HTTP/200 |
| Our Location & Culture – MDI Biological Laboratory /leadership/benjamin-d-humphreys-m-d-ph-d/ | 1429.8 ms | HTTP/200 |
| Our Leadership – MDI Biological Laboratory /leadership/leonard-zon-m-d/ | 1531.57 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /faculty/mario-schiffer/ | 1429.61 ms | HTTP/200 |
| Impact Report 2022 – MDI Biological Laboratory /leadership/eric-olson-ph-d/ | 1429.66 ms | HTTP/200 |
| Our History – MDI Biological Laboratory /leadership/rob-whitman/ | 709.53 ms | HTTP/200 |
| Timeline – MDI Biological Laboratory /a-busy-first-year-at-mdi-bioscience/ | 1733.65 ms | HTTP/200 |
| Research – MDI Biological Laboratory /leadership/nadia-rosenthal-ph-d-fmedsci-faahms/ | 1429.17 ms | HTTP/200 |
| Undergraduate and High School Programs – MDI Biological Laboratory /leadership/alejandro-sanchez-alvarado-ph-d/ | 1530.76 ms | HTTP/200 |
| Research Faculty – MDI Biological Laboratory /leadership/elly-margaret-tanaka-ph-d/ | 1733.39 ms | HTTP/200 |
| Research Programs – MDI Biological Laboratory /leadership/brad-thompson/ | 1733.47 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /leadership/andres-villu-maricq-m-d-ph-d/ | 1733.5 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /leadership/peter-walter-ph-d/ | 1733.49 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /leadership/jane-harrison/ | 708.37 ms | HTTP/200 |
| Scientific Resources – MDI Biological Laboratory /education/fellowships-training/inbre-summer-fellowships/ | 708.26 ms | HTTP/200 |
| Facilities (Research) – MDI Biological Laboratory /leadership/anna-maynard/ | 708.13 ms | HTTP/200 |
| MDI Biological Laboratory – Pioneering New Approaches in Regenerative Medicine /news/blog/page/3/ | 1021.61 ms | HTTP/200 |
| This Is Why – MDI Biological Laboratory /faculty/patricio-silva-m-d/ | 607.77 ms | HTTP/200 |
| Early-Stage In Vivo Profiling – MDI Biological Laboratory /news/press-releases/page/2/ | 607.63 ms | HTTP/200 |
| Simulated Biological Systems – MDI Biological Laboratory ...ublication/breaking-through-creating-a-center-of-biomedical-research-excellence/ | 1121.85 ms | HTTP/200 |
| Advanced Bioinformatics – MDI Biological Laboratory /publication/breaking-through-winter-2022/ | 607.25 ms | HTTP/200 |
| High Throughput Imaging – MDI Biological Laboratory /publication/breaking-through-fall-2020/ | 607.1 ms | HTTP/200 |
| 403 - Forbidden /support/giving-opportunities/labpartner/ | 1019.85 ms | HTTP/200 |
| Blog – MDI Biological Laboratory /starpointsociety/ | 606.74 ms | HTTP/200 |
| In the Media – MDI Biological Laboratory /tag/bidhi-diwedi/ | 1019.41 ms | HTTP/200 |
| Press Releases – MDI Biological Laboratory /support/get-involved/subscribe/ | 1121.26 ms | HTTP/200 |
| Publications – MDI Biological Laboratory /tag/kidney-graft/ | 1019 ms | HTTP/200 |
| Contact Media Affairs – MDI Biological Laboratory /tag/leif-oxburgh/ | 1323.91 ms | HTTP/200 |
| Support Us – MDI Biological Laboratory /tag/mdi-bio-lab/ | 1018.52 ms | HTTP/200 |
| Giving Opportunities – MDI Biological Laboratory /tag/mdibl/ | 1323.66 ms | HTTP/200 |
| Facilities (Education) – MDI Biological Laboratory /tag/mice/ | 1323.7 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /tag/mouse-kidney/ | 1424.66 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /tag/rogosin-institute/ | 1424.84 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /tag/visiting-scientist/ | 1424.6 ms | HTTP/200 |
| Get Involved – MDI Biological Laboratory /tag/sarcofish/ | 1424.79 ms | HTTP/200 |
| Stay Informed – MDI Biological Laboratory /tag/winter/ | 1628.09 ms | HTTP/200 |
| Inventing New Tools for Kidney-Grafting Biotech – MDI Biological Laboratory /tag/university-of-maine/ | 603.93 ms | HTTP/200 |
| Season Brings Snow, Students! – MDI Biological Laboratory /tag/inbre/ | 1730.34 ms | HTTP/200 |
| ...wo Summer Students Advanced Science at MDI Bio Lab – MDI Biological Laboratory /tag/reu/ | 1730.62 ms | HTTP/200 |
| ... $6,000 to Lab Ph.D. Candidate for Muscle Research – MDI Biological Laboratory /tag/summer-undergraduate-research-fellowship/ | 1730.67 ms | HTTP/200 |
| Noah Lind Finds a True Science Community – MDI Biological Laboratory /tag/surf/ | 1730.64 ms | HTTP/200 |
| MDI Bioscience – MDI Biological Laboratory /tag/taylor-stephens/ | 1730.68 ms | HTTP/200 |
| Graduate and Professional Programs – MDI Biological Laboratory /tag/biome/ | 1831.4 ms | HTTP/200 |
| Careers – MDI Biological Laboratory /tag/molecular-and-biomedical-science/ | 1831.71 ms | HTTP/200 |
| Contact – MDI Biological Laboratory /tag/romain-menard/ | 1932.42 ms | HTTP/200 |
| Center for Biomedical Research Excellence (COBRE) – MDI Biological Laboratory /tag/sanjushree-nagarajan/ | 1932.68 ms | HTTP/200 |
| IDeA Network of Biomedical Research Excellence – MDI Biological Laboratory /tag/sarcopenia/ | 1932.84 ms | HTTP/200 |
| Events – MDI Biological Laboratory /tag/abigail-wick/ | 1932.94 ms | HTTP/200 |
| Interactive Map – MDI Biological Laboratory /tag/noah-lind/ | 1932.95 ms | HTTP/200 |
| About – MDI Biological Laboratory /tag/this-is-why/ | 2034.19 ms | HTTP/200 |
| Our Location & Culture – MDI Biological Laboratory /recognizing-mdi-bio-labs-historian-in-chief-david-h-evans-ph-d/ | 601.44 ms | HTTP/200 |
| Our Leadership – MDI Biological Laboratory /mdi-bio-labs-alexis-garretson-wins-data-science-award/ | 2034.16 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory ...di-biological-laboratory-launches-new-drug-discovery-and-development-initiative/ | 1932.27 ms | HTTP/200 |
| Impact Report 2022 – MDI Biological Laboratory /careers/food-services-manager-year-round/ | 703.45 ms | HTTP/200 |
| Our History – MDI Biological Laboratory /careers/project-coordinator/ | 703.31 ms | HTTP/200 |
| Timeline – MDI Biological Laboratory /careers/science-communication-specialist/ | 703.17 ms | HTTP/200 |
| Research – MDI Biological Laboratory /news/blog/page/28/ | 2033.18 ms | HTTP/200 |
| Undergraduate and High School Programs – MDI Biological Laboratory ...son-university-students-faculty-share-projects-at-13th-annual-research-showcase/ | 2033.22 ms | HTTP/200 |
| Research Faculty – MDI Biological Laboratory /tag/chronic-kidney-disease/ | 2134.12 ms | HTTP/200 |
| Research Programs – MDI Biological Laboratory /leadership/20907/ | 2032.98 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /leadership/tom-rando-m-d-ph-d/ | 702.26 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /2022-publications/ | 2234.45 ms | HTTP/200 |
| Page not found – MDI Biological Laboratory /an-extraordinary-3d-microscope-opens-new-frontiers-in-biology/ | 702 ms | HTTP/200 |
| Scientific Resources – MDI Biological Laboratory /a-springboard-for-science-achievement-biomedical-education-on-maines-coast/ | 701.88 ms | HTTP/200 |
| Facilities (Research) – MDI Biological Laboratory /more-graduate-students-more-groundbreaking-science-at-mdibl/ | 701.73 ms | HTTP/200 |
| MDI Biological Laboratory – Pioneering New Approaches in Regenerative Medicine /wp-content/uploads/2022/12/2021-MDIBL-990-Public.pdf | 631.28 ms | HTTP/200 |
| This Is Why – MDI Biological Laboratory /wp-content/uploads/2023/11/MDIBL-2022-Audited-Financial-Statements.pdf | 630.58 ms | HTTP/200 |
| Early-Stage In Vivo Profiling – MDI Biological Laboratory ...mdi-biological-laboratory-scientist-advances-prospect-of-regeneration-in-humans/ | 630.23 ms | HTTP/200 |
| Simulated Biological Systems – MDI Biological Laboratory ...esearch/research-programs/center-for-biomedical-research-excellence/cobre-cores/ | 630.02 ms | HTTP/200 |
| Advanced Bioinformatics – MDI Biological Laboratory /tag/organoid/ | 1036.66 ms | HTTP/200 |
| High Throughput Imaging – MDI Biological Laboratory /research/research-programs/sepa/ | 629.62 ms | HTTP/200 |
Network informations and whois lookup for mdibl.org
Network Info from mdibl.org
| Contact | SOA Serial |
|---|---|
| ika@maine.edu | 906 |
mdibl.org IP Address (A)
| IP | Location | Provider |
|---|---|---|
| 34.174.22.245 245.22.174.34.bc.googleusercontent.com | North America / United States | GOOGLE-CLOUD-PLATFORM |
mdibl.org IPv6 Address (AAAA)
| IP | Location | Provider |
|---|
mdibl.org Mail Servers (MX)
| IP/Target | Location | Provider |
|---|---|---|
| 52.101.8.32 mdibl-org.mail.protection.outlook.com | North America / United States | MICROSOFT-CORP-MSN-AS-BLOCK |
mdibl.org Name Servers (NS)
| IP | Location | Provider |
|---|---|---|
| 130.111.130.7 namep.its.maine.edu | North America / United States | UMAINE-SYS-AS |
| 130.111.32.11 nameo.its.maine.edu | North America / United States | UMAINE-SYS-AS |
E-Mail Account Settings for mdibl.org
Are you trying to figure out what is mdibl.org mailbox / mail account settings - find mdibl.org mail settings below.
Please keep in mind these informations gathered based on mdibl.org network settings, it mostly works and correct, but might contains errors.
Outgoing SMTP Settings for mdibl.org
| Host | Port | Security Settings |
|---|---|---|
| smtp.office365.com | 587 | STARTTLS / TLS (Secure) |
Incoming IMAP4 Settings for mdibl.org
| Host | Port | Security Settings |
|---|---|---|
| outlook.office365.com | 993 | SSL (Secure) |
Incoming POP3 Settings for mdibl.org
| Host | Port | Security Settings |
|---|---|---|
| outlook.office365.com | 995 | SSL (Secure) |
Free Website SEO analytics for mdibl.org
This session was sponsored by nPulse.net (AI) - the most advanced website analytics software
Credits and Partners
All rights reserved nPulse.net 2009 - 2024
Powered by: MVCP 2.0-RC / BVCP / ASPF-MILTER / PHP 7.4 / NGINX / FreeBSD
