This is a snapshot from a website eggs.ca taken at 2026/04/25 10:35:04
eggs.ca

Home - Eggs.ca | Get Cracking

Headlines - H1,H2,H3 Tags very important and their hierarchia for crawlers

quick mealshow to fry the perfect egghow to poach an egg like a prohow to make hollandaise sauceegg timerbaked ham and egg cupsbreakfast power bowlcanadian farmhouse baked eggsscrambled eggsomelettes and frittatasperfect scrambled eggs with ham and cheesepopular recipesfamily-friendlysandwiches & wrapssoupabout uscontact usaccessibility policyprivacy policyhigh-protein chocolate mousseperfect homemade mayonnaiserecipeseggs 101recipe categorieslunch

Keywords - The most relevant keywords, (3 words) (2 words) (single word)

follow us onput an eggan egg onegg on itwhat’s for luncharound the worldterms & conditionseggs around theget the recipeegg fried ricesoft boiled eggsmight also likeyou might alsosubscribe to theenter your emailyour email addresseggs ca newsletterto the eggsthe eggs caegg farmers ofand poached eggsfarmers of canadaus on instagramup you'll bean error occurred

Website info about eggs.ca

Loading

Network informations and whois lookup for eggs.ca

Network Info from eggs.ca

ContactSOA Serial
postmaster@webnames.ca1773253126

E-Mail Account Settings for eggs.ca

Are you trying to figure out what is eggs.ca mailbox / mail account settings - find eggs.ca mail settings below.
Please keep in mind these informations gathered based on eggs.ca network settings, it mostly works and correct, but might contains errors.

Outgoing SMTP Settings for eggs.ca

HostPortSecurity Settings
smtp.office365.com587STARTTLS / TLS (Secure)

Incoming IMAP4 Settings for eggs.ca

HostPortSecurity Settings
outlook.office365.com993SSL (Secure)

Incoming POP3 Settings for eggs.ca

HostPortSecurity Settings
outlook.office365.com995SSL (Secure)

Free Website SEO analytics for eggs.ca

This session was sponsored by nPulse.net (AI) - the most advanced website analytics software

Speed Index ( 64 / 100 )

Speed Index shows how quickly the contents of a page are visibly populated.

5.0 s

Largest Contentful Paint ( 0 / 100 )

Largest Contentful Paint marks the time at which the largest text or image is painted.

10.4 s

Time to Interactive ( 3 / 100 )

Time to interactive is the amount of time it takes for the page to become fully interactive.

18.9 s

Total Blocking Time ( 4 / 100 )

Sum of all time periods between FCP and Time to Interactive, when task length exceeded 50ms, expressed in milliseconds.

2,820 ms

Cumulative Layout Shift ( 55 / 100 )

Cumulative Layout Shift measures the movement of visible elements within the viewport.

0.23

Max Potential First Input Delay ( 7 / 100 )

The maximum potential First Input Delay that your users could experience is the duration of the longest task.

530 ms

Properly size images ( 30 / 100 )

Serve images that are appropriately-sized to save cellular data and improve load time.

Potential savings of 474 KiB

Defer offscreen images ( 0 / 100 )

Consider lazy-loading offscreen and hidden images after all critical resources have finished loading to lower time to interactive.

Potential savings of 2,013 KiB

Reduce unused CSS ( 66 / 100 )

Reduce unused rules from stylesheets and defer CSS not used for above-the-fold content to decrease bytes consumed by network activity.

Potential savings of 27 KiB

Reduce unused JavaScript ( 26 / 100 )

Reduce unused JavaScript and defer loading scripts until they are required to decrease bytes consumed by network activity.

Potential savings of 471 KiB

Efficiently encode images ( 57 / 100 )

Optimized images load faster and consume less cellular data.

Potential savings of 109 KiB

Serve images in next-gen formats ( 0 / 100 )

Image formats like WebP and AVIF often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.

Potential savings of 1,081 KiB

Avoid enormous network payloads ( 59 / 100 )

Large network payloads cost users real money and are highly correlated with long load times.

Total size was 3,719 KiB

Serve static assets with an efficient cache policy ( 44 / 100 )

A long cache lifetime can speed up repeat visits to your page.

8 resources found

Reduce JavaScript execution time ( 34 / 100 )

Consider reducing the time spent parsing, compiling, and executing JS. You may find delivering smaller JS payloads helps with this.

4.9 s

Minimize main-thread work ( 9 / 100 )

Consider reducing the time spent parsing, compiling and executing JS. You may find delivering smaller JS payloads helps with this.

8.1 s

Ensure text remains visible during webfont load ( 0 / 100 )

Leverage the font-display CSS feature to ensure text is user-visible while webfonts are loading.

Reduce the impact of third-party code ( 0 / 100 )

Third-party code can significantly impact load performance. Limit the number of redundant third-party providers and try to load third-party code after your page has primarily finished loading.

Third-party code blocked the main thread for 2,180 ms

Image elements do not have explicit `width` and `height` ( 0 / 100 )

Set an explicit width and height on image elements to reduce layout shifts and improve CLS.

First Contentful Paint ( 85 / 100 )

First Contentful Paint marks the time at which the first text or image is painted.

2.0 s

First Meaningful Paint ( 95 / 100 )

First Meaningful Paint measures when the primary content of a page is visible.

2.0 s

Eliminate render-blocking resources ( 90 / 100 )

Resources are blocking the first paint of your page. Consider delivering critical JS/CSS inline and deferring all non-critical JS/styles.

Potential savings of 120 ms

Minify CSS ( 100 / 100 )

Minifying CSS files can reduce network payload sizes.

Minify JavaScript ( 100 / 100 )

Minifying JavaScript files can reduce payload sizes and script parse time.

Enable text compression ( 100 / 100 )

Text-based resources should be served with compression (gzip, deflate or brotli) to minimize total network bytes.

Preconnect to required origins ( 100 / 100 )

Consider adding `preconnect` or `dns-prefetch` resource hints to establish early connections to important third-party origins.

Initial server response time was short ( 100 / 100 )

Keep the server response time for the main document short because all other requests depend on it.

Root document took 20 ms

Avoid multiple page redirects ( 100 / 100 )

Redirects introduce additional delays before the page can be loaded.

Potential savings of 640 ms

Preload key requests

Consider using `<link rel=preload>` to prioritize fetching resources that are currently requested later in page load.

Use HTTP/2 ( 100 / 100 )

HTTP/2 offers many benefits over HTTP/1.1, including binary headers and multiplexing.

Use video formats for animated content ( 100 / 100 )

Large GIFs are inefficient for delivering animated content. Consider using MPEG4/WebM videos for animations and PNG/WebP for static images instead of GIF to save network bytes.

Remove duplicate modules in JavaScript bundles ( 100 / 100 )

Remove large, duplicate JavaScript modules from bundles to reduce unnecessary bytes consumed by network activity.

Avoid serving legacy JavaScript to modern browsers ( 100 / 100 )

Polyfills and transforms enable legacy browsers to use new JavaScript features. However, many aren't necessary for modern browsers. For your bundled JavaScript, adopt a modern script deployment strategy using module/nomodule feature detection to reduce the amount of code shipped to modern browsers, while retaining support for legacy browsers. [Learn More](https://philipwalton.com/articles/deploying-es2015-code-in-production-today/)

Potential savings of 11 KiB

Preload Largest Contentful Paint image

Preload the image used by the LCP element in order to improve your LCP time.

Avoids an excessive DOM size ( 99 / 100 )

A large DOM will increase memory usage, cause longer [style calculations](https://developers.google.com/web/fundamentals/performance/rendering/reduce-the-scope-and-complexity-of-style-calculations), and produce costly [layout reflows](https://developers.google.com/speed/articles/reflow).

521 elements

Avoid chaining critical requests

The Critical Request Chains below show you what resources are loaded with a high priority. Consider reducing the length of chains, reducing the download size of resources, or deferring the download of unnecessary resources to improve page load.

5 chains found

User Timing marks and measures

Consider instrumenting your app with the User Timing API to measure your app's real-world performance during key user experiences.

Performance budget

Keep the quantity and size of network requests under the targets set by the provided performance budget.

Timing budget

Set a timing budget to help you keep an eye on the performance of your site. Performant sites load fast and respond to user input events quickly.

Keep request counts low and transfer sizes small

To set budgets for the quantity and size of page resources, add a budget.json file.

89 requests • 3,719 KiB

Lazy load third-party resources with facades

Some third-party embeds can be lazy loaded. Consider replacing them with a facade until they are required.

Largest Contentful Paint element

This is the largest contentful element painted within the viewport. [Learn More](https://web.dev/lighthouse-largest-contentful-paint/)

1 element found

Avoid large layout shifts

These DOM elements contribute most to the CLS of the page.

4 elements found

Uses passive listeners to improve scrolling performance ( 100 / 100 )

Consider marking your touch and wheel event listeners as `passive` to improve your page's scroll performance.

Avoids `document.write()` ( 100 / 100 )

For users on slow connections, external scripts dynamically injected via `document.write()` can delay page load by tens of seconds.

Avoid long main-thread tasks

Lists the longest tasks on the main thread, useful for identifying worst contributors to input delay.

20 long tasks found

Avoid non-composited animations

Animations which are not composited can be janky and increase CLS.

Network Requests

Lists the network requests that were made during page load.

Network Round Trip Times

Network round trip times (RTT) have a large impact on performance. If the RTT to an origin is high, it's an indication that servers closer to the user could improve performance.

20 ms

Server Backend Latencies

Server latencies can impact web performance. If the server latency of an origin is high, it's an indication the server is overloaded or has poor backend performance.

190 ms

Tasks

Lists the toplevel main thread tasks that executed during page load.

Diagnostics

Collection of useful page vitals.

Metrics

Collects all available metrics.

Screenshot Thumbnails

This is what the load of your site looked like.

Final Screenshot

The last screenshot captured of the pageload.

Script Treemap Data

Used for treemap app

`[aria-*]` attributes do not match their roles ( 0 / 100 )

Each ARIA `role` supports a specific subset of `aria-*` attributes. Mismatching these invalidates the `aria-*` attributes.

Background and foreground colors do not have a sufficient contrast ratio. ( 0 / 100 )

Low-contrast text is difficult or impossible for many users to read.

`[accesskey]` values are unique

Access keys let users quickly focus a part of the page. For proper navigation, each access key must be unique.

`button`, `link`, and `menuitem` elements have accessible names

When an element doesn't have an accessible name, screen readers announce it with a generic name, making it unusable for users who rely on screen readers.

`[aria-hidden="true"]` is not present on the document `<body>` ( 100 / 100 )

Assistive technologies, like screen readers, work inconsistently when `aria-hidden="true"` is set on the document `<body>`.

`[aria-hidden="true"]` elements do not contain focusable descendents ( 100 / 100 )

Focusable descendents within an `[aria-hidden="true"]` element prevent those interactive elements from being available to users of assistive technologies like screen readers.

ARIA input fields have accessible names

When an input field doesn't have an accessible name, screen readers announce it with a generic name, making it unusable for users who rely on screen readers.

ARIA `meter` elements have accessible names

When an element doesn't have an accessible name, screen readers announce it with a generic name, making it unusable for users who rely on screen readers.

ARIA `progressbar` elements have accessible names

When a `progressbar` element doesn't have an accessible name, screen readers announce it with a generic name, making it unusable for users who rely on screen readers.

`[role]`s have all required `[aria-*]` attributes

Some ARIA roles have required attributes that describe the state of the element to screen readers.

Elements with an ARIA `[role]` that require children to contain a specific `[role]` have all required children.

Some ARIA parent roles must contain specific child roles to perform their intended accessibility functions.

`[role]`s are contained by their required parent element

Some ARIA child roles must be contained by specific parent roles to properly perform their intended accessibility functions.

`[role]` values are valid

ARIA roles must have valid values in order to perform their intended accessibility functions.

ARIA toggle fields have accessible names

When a toggle field doesn't have an accessible name, screen readers announce it with a generic name, making it unusable for users who rely on screen readers.

ARIA `tooltip` elements have accessible names

When an element doesn't have an accessible name, screen readers announce it with a generic name, making it unusable for users who rely on screen readers.

ARIA `treeitem` elements have accessible names

When an element doesn't have an accessible name, screen readers announce it with a generic name, making it unusable for users who rely on screen readers.

`[aria-*]` attributes have valid values ( 100 / 100 )

Assistive technologies, like screen readers, can't interpret ARIA attributes with invalid values.

`[aria-*]` attributes are valid and not misspelled ( 100 / 100 )

Assistive technologies, like screen readers, can't interpret ARIA attributes with invalid names.

Buttons have an accessible name ( 100 / 100 )

When a button doesn't have an accessible name, screen readers announce it as "button", making it unusable for users who rely on screen readers.

The page contains a heading, skip link, or landmark region ( 100 / 100 )

Adding ways to bypass repetitive content lets keyboard users navigate the page more efficiently.

`<dl>`'s contain only properly-ordered `<dt>` and `<dd>` groups, `<script>`, `<template>` or `<div>` elements.

When definition lists are not properly marked up, screen readers may produce confusing or inaccurate output.

Definition list items are wrapped in `<dl>` elements

Definition list items (`<dt>` and `<dd>`) must be wrapped in a parent `<dl>` element to ensure that screen readers can properly announce them.

Document has a `<title>` element ( 100 / 100 )

The title gives screen reader users an overview of the page, and search engine users rely on it heavily to determine if a page is relevant to their search.

`[id]` attributes on active, focusable elements are unique ( 100 / 100 )

All focusable elements must have a unique `id` to ensure that they're visible to assistive technologies.

ARIA IDs are unique

The value of an ARIA ID must be unique to prevent other instances from being overlooked by assistive technologies.

No form fields have multiple labels

Form fields with multiple labels can be confusingly announced by assistive technologies like screen readers which use either the first, the last, or all of the labels.

`<frame>` or `<iframe>` elements have a title

Screen reader users rely on frame titles to describe the contents of frames.

Heading elements appear in a sequentially-descending order ( 100 / 100 )

Properly ordered headings that do not skip levels convey the semantic structure of the page, making it easier to navigate and understand when using assistive technologies.

`<html>` element has a `[lang]` attribute ( 100 / 100 )

If a page doesn't specify a lang attribute, a screen reader assumes that the page is in the default language that the user chose when setting up the screen reader. If the page isn't actually in the default language, then the screen reader might not announce the page's text correctly.

`<html>` element has a valid value for its `[lang]` attribute ( 100 / 100 )

Specifying a valid [BCP 47 language](https://www.w3.org/International/questions/qa-choosing-language-tags#question) helps screen readers announce text properly.

Image elements have `[alt]` attributes ( 100 / 100 )

Informative elements should aim for short, descriptive alternate text. Decorative elements can be ignored with an empty alt attribute.

`<input type="image">` elements have `[alt]` text

When an image is being used as an `<input>` button, providing alternative text can help screen reader users understand the purpose of the button.

Form elements have associated labels ( 100 / 100 )

Labels ensure that form controls are announced properly by assistive technologies, like screen readers.

Links have a discernible name ( 100 / 100 )

Link text (and alternate text for images, when used as links) that is discernible, unique, and focusable improves the navigation experience for screen reader users.

Lists contain only `<li>` elements and script supporting elements (`<script>` and `<template>`). ( 100 / 100 )

Screen readers have a specific way of announcing lists. Ensuring proper list structure aids screen reader output.

List items (`<li>`) are contained within `<ul>` or `<ol>` parent elements ( 100 / 100 )

Screen readers require list items (`<li>`) to be contained within a parent `<ul>` or `<ol>` to be announced properly.

The document does not use `<meta http-equiv="refresh">`

Users do not expect a page to refresh automatically, and doing so will move focus back to the top of the page. This may create a frustrating or confusing experience.

`[user-scalable="no"]` is not used in the `<meta name="viewport">` element and the `[maximum-scale]` attribute is not less than 5. ( 100 / 100 )

Disabling zooming is problematic for users with low vision who rely on screen magnification to properly see the contents of a web page.

`<object>` elements have `[alt]` text

Screen readers cannot translate non-text content. Adding alt text to `<object>` elements helps screen readers convey meaning to users.

No element has a `[tabindex]` value greater than 0

A value greater than 0 implies an explicit navigation ordering. Although technically valid, this often creates frustrating experiences for users who rely on assistive technologies.

Cells in a `<table>` element that use the `[headers]` attribute refer to table cells within the same table.

Screen readers have features to make navigating tables easier. Ensuring `<td>` cells using the `[headers]` attribute only refer to other cells in the same table may improve the experience for screen reader users.

`<th>` elements and elements with `[role="columnheader"/"rowheader"]` have data cells they describe.

Screen readers have features to make navigating tables easier. Ensuring table headers always refer to some set of cells may improve the experience for screen reader users.

`[lang]` attributes have a valid value

Specifying a valid [BCP 47 language](https://www.w3.org/International/questions/qa-choosing-language-tags#question) on elements helps ensure that text is pronounced correctly by a screen reader.

`<video>` elements contain a `<track>` element with `[kind="captions"]`

When a video provides a caption it is easier for deaf and hearing impaired users to access its information.

The page has a logical tab order

Tabbing through the page follows the visual layout. Users cannot focus elements that are offscreen.

Interactive controls are keyboard focusable

Custom interactive controls are keyboard focusable and display a focus indicator.

Interactive elements indicate their purpose and state

Interactive elements, such as links and buttons, should indicate their state and be distinguishable from non-interactive elements.

The user's focus is directed to new content added to the page

If new content, such as a dialog, is added to the page, the user's focus is directed to it.

User focus is not accidentally trapped in a region

A user can tab into and out of any control or region without accidentally trapping their focus.

Custom controls have associated labels

Custom interactive controls have associated labels, provided by aria-label or aria-labelledby.

Custom controls have ARIA roles

Custom interactive controls have appropriate ARIA roles.

Visual order on the page follows DOM order

DOM order matches the visual order, improving navigation for assistive technology.

Offscreen content is hidden from assistive technology

Offscreen content is hidden with display: none or aria-hidden=true.

HTML5 landmark elements are used to improve navigation

Landmark elements (<main>, <nav>, etc.) are used to improve the keyboard navigation of the page for assistive technology.

Does not use HTTPS ( 0 / 100 )

All sites should be protected with HTTPS, even ones that don't handle sensitive data. This includes avoiding [mixed content](https://developers.google.com/web/fundamentals/security/prevent-mixed-content/what-is-mixed-content), where some resources are loaded over HTTP despite the initial request being served over HTTPS. HTTPS prevents intruders from tampering with or passively listening in on the communications between your app and your users, and is a prerequisite for HTTP/2 and many new web platform APIs.

1 insecure request found

Links to cross-origin destinations are unsafe ( 0 / 100 )

Add `rel="noopener"` or `rel="noreferrer"` to any external links to improve performance and prevent security vulnerabilities.

Uses deprecated APIs ( 0 / 100 )

Deprecated APIs will eventually be removed from the browser.

1 warning found

Browser errors were logged to the console ( 0 / 100 )

Errors logged to the console indicate unresolved problems. They can come from network request failures and other browser concerns.

Avoids requesting the geolocation permission on page load ( 100 / 100 )

Users are mistrustful of or confused by sites that request their location without context. Consider tying the request to a user action instead.

Avoids requesting the notification permission on page load ( 100 / 100 )

Users are mistrustful of or confused by sites that request to send notifications without context. Consider tying the request to user gestures instead.

Avoids front-end JavaScript libraries with known security vulnerabilities ( 100 / 100 )

Some third-party scripts may contain known security vulnerabilities that are easily identified and exploited by attackers.

Ensure CSP is effective against XSS attacks

A strong Content Security Policy (CSP) significantly reduces the risk of cross-site scripting (XSS) attacks.

Allows users to paste into password fields ( 100 / 100 )

Preventing password pasting undermines good security policy.

Displays images with correct aspect ratio ( 100 / 100 )

Image display dimensions should match natural aspect ratio.

Serves images with appropriate resolution ( 100 / 100 )

Image natural dimensions should be proportional to the display size and the pixel ratio to maximize image clarity.

Fonts with `font-display: optional` are preloaded

Preload `optional` fonts so first-time visitors may use them.

Page has the HTML doctype ( 100 / 100 )

Specifying a doctype prevents the browser from switching to quirks-mode.

Properly defines charset ( 100 / 100 )

A character encoding declaration is required. It can be done with a `<meta>` tag in the first 1024 bytes of the HTML or in the Content-Type HTTP response header.

Avoids `unload` event listeners ( 100 / 100 )

The `unload` event does not fire reliably and listening for it can prevent browser optimizations like the Back-Forward Cache. Consider using the `pagehide` or `visibilitychange` events instead.

Avoids Application Cache ( 100 / 100 )

Application Cache is deprecated.

Detected JavaScript libraries ( 100 / 100 )

All front-end JavaScript libraries detected on the page.

Page has valid source maps ( 100 / 100 )

Source maps translate minified code to the original source code. This helps developers debug in production. In addition, Lighthouse is able to provide further insights. Consider deploying source maps to take advantage of these benefits.

No issues in the `Issues` panel in Chrome Devtools ( 100 / 100 )

Issues logged to the `Issues` panel in Chrome Devtools indicate unresolved problems. They can come from network request failures, insufficient security controls, and other browser concerns. Open up the Issues panel in Chrome DevTools for more details on each issue.

Document does not have a meta description ( 0 / 100 )

Meta descriptions may be included in search results to concisely summarize page content.

Has a `<meta name="viewport">` tag with `width` or `initial-scale` ( 100 / 100 )

Add a `<meta name="viewport">` tag to optimize your app for mobile screens.

Document has a `<title>` element ( 100 / 100 )

The title gives screen reader users an overview of the page, and search engine users rely on it heavily to determine if a page is relevant to their search.

Page has successful HTTP status code ( 100 / 100 )

Pages with unsuccessful HTTP status codes may not be indexed properly.

Links have descriptive text ( 100 / 100 )

Descriptive link text helps search engines understand your content.

Links are crawlable ( 100 / 100 )

Search engines may use `href` attributes on links to crawl websites. Ensure that the `href` attribute of anchor elements links to an appropriate destination, so more pages of the site can be discovered. [Learn More](https://support.google.com/webmasters/answer/9112205)

Page isn’t blocked from indexing ( 100 / 100 )

Search engines are unable to include your pages in search results if they don't have permission to crawl them.

robots.txt is valid ( 100 / 100 )

If your robots.txt file is malformed, crawlers may not be able to understand how you want your website to be crawled or indexed.

Image elements have `[alt]` attributes ( 100 / 100 )

Informative elements should aim for short, descriptive alternate text. Decorative elements can be ignored with an empty alt attribute.

Document has a valid `hreflang` ( 100 / 100 )

hreflang links tell search engines what version of a page they should list in search results for a given language or region.

Document has a valid `rel=canonical` ( 100 / 100 )

Canonical links suggest which URL to show in search results.

Document uses legible font sizes ( 100 / 100 )

Font sizes less than 12px are too small to be legible and require mobile visitors to “pinch to zoom” in order to read. Strive to have >60% of page text ≥12px.

100% legible text

Document avoids plugins ( 100 / 100 )

Search engines can't index plugin content, and many devices restrict plugins or don't support them.

Tap targets are sized appropriately ( 100 / 100 )

Interactive elements like buttons and links should be large enough (48x48px), and have enough space around them, to be easy enough to tap without overlapping onto other elements.

100% appropriately sized tap targets

Structured data is valid

Run the [Structured Data Testing Tool](https://search.google.com/structured-data/testing-tool/) and the [Structured Data Linter](http://linter.structured-data.org/) to validate structured data.

Does not register a service worker that controls page and `start_url` ( 0 / 100 )

The service worker is the technology that enables your app to use many Progressive Web App features, such as offline, add to homescreen, and push notifications.

Is not configured for a custom splash screen ( 0 / 100 )

A themed splash screen ensures a high-quality experience when users launch your app from their homescreens.

Failures: Manifest does not have `name`.

Manifest doesn't have a maskable icon ( 0 / 100 )

A maskable icon ensures that the image fills the entire shape without being letterboxed when installing the app on a device.

Web app manifest and service worker meet the installability requirements ( 100 / 100 )

Service worker is the technology that enables your app to use many Progressive Web App features, such as offline, add to homescreen, and push notifications. With proper service worker and manifest implementations, browsers can proactively prompt users to add your app to their homescreen, which can lead to higher engagement.

Redirects HTTP traffic to HTTPS ( 100 / 100 )

If you've already set up HTTPS, make sure that you redirect all HTTP traffic to HTTPS in order to enable secure web features for all your users.

Sets a theme color for the address bar. ( 100 / 100 )

The browser address bar can be themed to match your site.

Content is sized correctly for the viewport ( 100 / 100 )

If the width of your app's content doesn't match the width of the viewport, your app might not be optimized for mobile screens.

Has a `<meta name="viewport">` tag with `width` or `initial-scale` ( 100 / 100 )

Add a `<meta name="viewport">` tag to optimize your app for mobile screens.

Provides a valid `apple-touch-icon` ( 100 / 100 )

For ideal appearance on iOS when users add a progressive web app to the home screen, define an `apple-touch-icon`. It must point to a non-transparent 192px (or 180px) square PNG. [Learn More](https://web.dev/apple-touch-icon/).

Site works cross-browser

To reach the most number of users, sites should work across every major browser.

Page transitions don't feel like they block on the network

Transitions should feel snappy as you tap around, even on a slow network. This experience is key to a user's perception of performance.

Each page has a URL

Ensure individual pages are deep linkable via URL and that URLs are unique for the purpose of shareability on social media.

All rights reserved nPulse.net 2009 - 2026
Powered by: MVCP2 / BVCP / ASPF-MILTER / PHP 8.3 / NGINX / FreeBSD